Natto Genome Project
Bacillus subtilis subsp. natto str. BEST195

Home About Browser Genes Download Publications

Amino acid alignment: BSNT_05199 and BSU34420

See DNA alignment / Visit BSNT_05199 in genome browser / Return to Orthologue table
########################################
# Program: needle
# Rundate: Mon  8 Mar 2010 06:25:52
# Commandline: needle
#    -asequence pep-align/BSNT_05199.1.22522.seq
#    -bsequence pep-align/BSU34420___yveF.2.22522.seq
#    -gapopen 10
#    -gapextend 0.5
#    -outfile pep-align/BSNT_05199-BSU34420___yveF.aln
# Align_format: srspair
# Report_file: pep-align/BSNT_05199-BSU34420___yveF.aln
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: BSNT_05199
# 2: BSU34420___yveF
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 56
# Identity:      29/56 (51.8%)
# Similarity:    29/56 (51.8%)
# Gaps:          26/56 (46.4%)
# Score: 145.0
# 
#
#=======================================

BSNT_05199         1 MKKPVLKPFASLEIKVDPPIVIGETSLGLRRFIPIRSGTITGEVKGRILP     50
                     ||||||||||||||||||||.|||||||||                    
BSU34420___yv      1 MKKPVLKPFASLEIKVDPPITIGETSLGLR--------------------     30

BSNT_05199        51 GVPIHK     56
                           
BSU34420___yv     30 ------     30


#---------------------------------------
#---------------------------------------
Copyright (C) Natto Genome Project, 2009-2010. All rights reserved.