Natto Genome Project
Bacillus subtilis subsp. natto str. BEST195

Home About Browser Genes Download Publications

Amino acid alignment: BSNT_05907 and BPUM_3510

See DNA alignment / Visit BSNT_05907 in genome browser / Return to Orthologue table
########################################
# Program: needle
# Rundate: Mon  8 Mar 2010 06:26:28
# Commandline: needle
#    -asequence pep-align/BSNT_05907.1.24716.seq
#    -bsequence pep-align/BPUM_3510___yxzF.2.24716.seq
#    -gapopen 10
#    -gapextend 0.5
#    -outfile pep-align/BSNT_05907-BPUM_3510___yxzF.aln
# Align_format: srspair
# Report_file: pep-align/BSNT_05907-BPUM_3510___yxzF.aln
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: BSNT_05907
# 2: BPUM_3510___yxzF
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 61
# Identity:      22/61 (36.1%)
# Similarity:    30/61 (49.2%)
# Gaps:          24/61 (39.3%)
# Score: 128.0
# 
#
#=======================================

BSNT_05907         1 MFKEEAIRGMVEKKEGRIGALKKMIKTVIKWAPVIYPIVRKIMKDRKVCK     50
                                         :||.:|.:.||||||||:||||.|:||..|
BPUM_3510___y      1 --------------------MKKWLKQIFKWAPVIYPVVRKIYKERKASK     30

BSNT_05907        51 QKNMSASRTAG     61
                     ::|:||.    
BPUM_3510___y     31 RRNVSAG----     37


#---------------------------------------
#---------------------------------------
Copyright (C) Natto Genome Project, 2009-2010. All rights reserved.