Natto Genome Project
Bacillus subtilis subsp. natto str. BEST195

Home About Browser Genes Download Publications

Amino acid alignment: BSNT_01651 and BL02878

See DNA alignment / Visit BSNT_01651 in genome browser / Return to Orthologue table
########################################
# Program: needle
# Rundate: Mon  8 Mar 2010 06:23:07
# Commandline: needle
#    -asequence pep-align/BSNT_01651.1.5803.seq
#    -bsequence pep-align/BL02878___yhdX.2.5803.seq
#    -gapopen 10
#    -gapextend 0.5
#    -outfile pep-align/BSNT_01651-BL02878___yhdX.aln
# Align_format: srspair
# Report_file: pep-align/BSNT_01651-BL02878___yhdX.aln
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: BSNT_01651
# 2: BL02878___yhdX
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 47
# Identity:      29/47 (61.7%)
# Similarity:    32/47 (68.1%)
# Gaps:          12/47 (25.5%)
# Score: 140.0
# 
#
#=======================================

BSNT_01651         1 MILYNSKKGGEIMGKGRIRVEERIKAETDAEMQKATLLDQTQTKKGK     47
                                 ||||||:||||||.||||||.|||||||||::|.|
BL02878___yhd      1 ------------MGKGRIKVEERIKIETDAEMFKATLLDQTQSQKKK     35


#---------------------------------------
#---------------------------------------
Copyright (C) Natto Genome Project, 2009-2010. All rights reserved.