Natto Genome Project
Bacillus subtilis subsp. natto str. BEST195

Home About Browser Genes Download Publications

Amino acid alignment: BSNT_00449 and RBAM_002840

See DNA alignment / Visit BSNT_00449 in genome browser / Return to Orthologue table
########################################
# Program: needle
# Rundate: Mon  8 Mar 2010 06:22:12
# Commandline: needle
#    -asequence pep-align/BSNT_00449___yczA.1.9828.seq
#    -bsequence pep-align/RBAM_002840___rtpA.2.9828.seq
#    -gapopen 10
#    -gapextend 0.5
#    -outfile pep-align/BSNT_00449___yczA-RBAM_002840___rtpA.aln
# Align_format: srspair
# Report_file: pep-align/BSNT_00449___yczA-RBAM_002840___rtpA.aln
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: BSNT_00449___yczA
# 2: RBAM_002840___rtpA
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 68
# Identity:      38/68 (55.9%)
# Similarity:    43/68 (63.2%)
# Gaps:          15/68 (22.1%)
# Score: 197.0
# 
#
#=======================================

BSNT_00449___      1 --------------MVIATDDLEVACPKCERAG-EIEGTPCPACSGKGVI     35
                                   |||||||||:.||.||..| |.||||||.|..||||
RBAM_002840__      1 MTGDGQTIKKGGIFMVIATDDLELTCPHCEGTGEEKEGTPCPKCGAKGVI     50

BSNT_00449___     36 LTAQGYTLLDFIQKHLNK     53
                     |||||.|||.||:||:::
RBAM_002840__     51 LTAQGNTLLHFIRKHIDQ     68


#---------------------------------------
#---------------------------------------
Copyright (C) Natto Genome Project, 2009-2010. All rights reserved.